1st International and 10th National Iranian Conference on Bioinformatics
Home Accepted Papers
Bioinformatics analysis of the key enzyme of important volatile phenylpropanoid pathway in Ocimum basilicum
Paper ID : 1322-ICB10
Authors:
Fatemeh Khakdan *1, Zeynab Zare2
1گروه زیست شناسی، پردیس فرزانگان، دانشگاه سمنان، سمنان
2گروه بیوشیمی، دانشکده دامپزشکی، دانشگاه ارومیه، ارومیه
Abstract:
Essential oils of O. basilicum are rich in phenylpropanes like chavicol, methylchavicol, eugenol, methyleugenol, and some terpenoid compounds, which are contributed to the particular properties of many spices and herbs [1]. The final step in the biosynthesis of the methylchavicol, the conversion of chavicol to methylchavicol, is catalyzed by the enzyme chavicol O-methyltransferase (CVOMT) [2]. Here, we study the structural and functional important regions (motif prediction), conserved domains, protein domain families, catalytic domains were detected in the protein sequence via PROSITE, InterProScan, ProDom, TrEMBL, respectively. PSORT Prediction, predict Nuclear Localization Signals (NLS) tool and Subcellular location prediction (PLS) web tools. The ObCVOMT protein molecular mass was predicted to be about 39.95 kDa and the isoelectric point was predicted to be at 5.58 calculated. In addition, the putative amino acids sequence revealed more homology with conserved active site consensus sequence of all the PAL protein conserved motifs (MSLKCAIQLGIPDILHKHDHPMTLSQLLQAIPINKEKSQSFQRLMRALV), and belongs to the class I-like SAM-binding methyltransferase superfamily and Cation-independent O-methyltransferase family. MotifScan results revealed that the protein sequence of ObCVOMT had 11 catalytic domains consisting of eight different catalytic domains viz. ASN_GLYCOSYLATION (N-glycosylation site), CK2_PHOSPHO_SITE (Casein kinase II phosphorylation site), MYRISTYL (N-myristoylation site). Results from protein structure modeling program SOPMA revealed that predicted ObCVOMT protein was a predominantly α-helical protein, which mainly consisted of alpha helices (49.16%) and random coils (32.02%), extended strands (13.48%), and 5.34% beta turns [3].
Keywords:
ObCVOMT, Catalytic domains, Conserved domains, protein structure modeling, motif scan
Status : Paper Accepted (Poster Presentation)