1st International and 10th National Iranian Conference on Bioinformatics
Home Accepted Papers
Investigation of structural properties of lunasin with computational tools
Paper ID : 1399-ICB10
Authors:
Fatemeh Safakhah *
گروه بیوتکنولوژی، دانشکده علوم زیستی، دانشگاه الزهرا، تهران، ایران
Abstract:
Lunasin is a soy-derived chemical that slows the proliferation of newly identified cancer cells. This substance's anti-cancer properties have gotten increased attention .In the treatment of disorders, lunasin has been found to have cholesterol-lowering and hypertensive effects. Lunasin is a 43-amino-acid peptide having a SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD sequence and a molecular weight of 5.5 KDa .Tumor cells can adhere to the extracellular matrix due to the RGD motif found in lunasin. In fact, by fighting for adhesion, the peptides in this motif can suppress cancer.
The properties of lunacin were investigated using computational tools using bioinformatics tools. The second structure of lunasin was derived using the database http://cib.cf.ocha.ac.jp/bitool/MIX, then its third structure was analyzed utilizing the ITASSER database due to laboratory restrictions and the tiny size of this sequenc .Its structure is seen using the Spdb viewer software. The Co - factor server was used to find the peptide's functional area. The hotspot wizard server looked at possible locations for examining mutations in the structure of lunasin. It was tested utilizing a prosper site and a peptide cutter to make greater utilization of enzymes. The anticp database was used to investigate cancer qualities, as well as other ACPHP properties.
The amino acids S1, R1, R3, T3, K2, K24, K29, K12, and D18 from the region that plays a role in stability can be altered, however the functional region cannot. The results revealed that this peptide possesses anti-cancer capabilities, with KHIMG receiving the highest score of 87%. QGRGDDDDDD has also been discovered to have antihypertensive characteristics, with an 81 percent score.
CNBr enzymes were found to be capable of selective cleavage of the lunasin peptide Chymotripsine, Clostripain.
Keywords:
Computing tools, cancer, soybeans, active peptides, components
Status : Paper Accepted (Poster Presentation)